PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi02g10650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family SBP
Protein Properties Length: 223aa    MW: 24789 Da    PI: 9.2335
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi02g10650.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP136.21e-42109185278
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      Cq+e+C adl++ak+yhrrhkvCe+hskapvv+v+gl+qrfCqqCsrfh+l efDe+krsCrrrLa+hnerrrk+++
  Vradi02g10650.1 109 CQAERCGADLTDAKRYHRRHKVCEFHSKAPVVVVAGLRQRFCQQCSRFHDLAEFDESKRSCRRRLAGHNERRRKSNP 185
                      **************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.0E-35102170IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.753106183IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.32E-40107187IPR004333Transcription factor, SBP-box
PfamPF031108.1E-32109182IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MEPVVHTLLF CPSASYKLPL SLHCSKKLLP LCNTLLHTME RKRSLLERVR KNVEEELENE  60
LEEEDETGPS LTEEEKKRGL GSSNTGGGRR ASTGAAAAAS GGGVSPPSCQ AERCGADLTD  120
AKRYHRRHKV CEFHSKAPVV VVAGLRQRFC QQCSRFHDLA EFDESKRSCR RRLAGHNERR  180
RKSNPEAANE GSKGHQHPKE TTHCRIQMNL PGSSGYKSFN IR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-36100182284squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150391e-146AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014493466.11e-163PREDICTED: squamosa promoter-binding-like protein 3
TrEMBLA0A0L9V2Q02e-82A0A0L9V2Q0_PHAAN; Uncharacterized protein
TrEMBLA0A0S3S9K72e-82A0A0S3S9K7_PHAAN; Uncharacterized protein
STRINGGLYMA06G36140.13e-77(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53534153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.21e-40squamosa promoter binding protein-like 4